CDS

Accession Number TCMCG068C56935
gbkey CDS
Protein Id KAG5624806.1
Location complement(join(50975986..50976077,50976514..50976592,50978646..50978744))
Organism Solanum commersonii
locus_tag H5410_010024

Protein

Length 89aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA655804, BioSample:SAMN15755581
db_source JACXVP010000002.1
Definition hypothetical protein H5410_010024 [Solanum commersonii]
Locus_tag H5410_010024

EGGNOG-MAPPER Annotation

COG_category O
Description PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE -
KEGG_ko -
EC -
KEGG_Pathway -
GOs GO:0000413        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003755        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005768        [VIEW IN EMBL-EBI]
GO:0005770        [VIEW IN EMBL-EBI]
GO:0005771        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005794        [VIEW IN EMBL-EBI]
GO:0005795        [VIEW IN EMBL-EBI]
GO:0005802        [VIEW IN EMBL-EBI]
GO:0005829        [VIEW IN EMBL-EBI]
GO:0006464        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016853        [VIEW IN EMBL-EBI]
GO:0016859        [VIEW IN EMBL-EBI]
GO:0018193        [VIEW IN EMBL-EBI]
GO:0018208        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0031410        [VIEW IN EMBL-EBI]
GO:0031982        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0036211        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043412        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044431        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0097708        [VIEW IN EMBL-EBI]
GO:0098791        [VIEW IN EMBL-EBI]
GO:0140096        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGGTAGAGCGATCTCAGTTTTATTGCAGCCTCGATGGATTCTGATCTTTCTTGGGGTTTTACTTGTTATCTTTCTTGCATCTTCCATCTTCCAAAAGGAACATGAGATGGTGGACGAGGTGTATGAAGTTACCCACAGAGTATTCTTGGATGTGGATATAGATAAACAACGTGCAGACAAGCTGTGGTTTGGTATAGTATGTGCTTCATTCAAGGACAATGATACTAATGAACTTGCATTGCTCTATACTAGCCCTGTTCCGCGCTAA
Protein:  
MGRAISVLLQPRWILIFLGVLLVIFLASSIFQKEHEMVDEVYEVTHRVFLDVDIDKQRADKLWFGIVCASFKDNDTNELALLYTSPVPR